Lineage for d2ypvl1 (2ypv L:1-107)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2754035Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2754036Protein automated matches [190740] (31 species)
    not a true protein
  7. 2759478Species Mouse (Mus musculus) [TaxId:10090] [188198] (836 PDB entries)
  8. 2759536Domain d2ypvl1: 2ypv L:1-107 [207715]
    Other proteins in same PDB: d2ypvh1, d2ypvh2, d2ypvl2
    automated match to d1dqdl1
    complexed with edo

Details for d2ypvl1

PDB Entry: 2ypv (more details), 1.8 Å

PDB Description: Crystal structure of the Meningococcal vaccine antigen factor H binding protein in complex with a bactericidal antibody
PDB Compounds: (L:) fab 12c1

SCOPe Domain Sequences for d2ypvl1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ypvl1 b.1.1.0 (L:1-107) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
divltqspssiyaslgervtltckasqdihnylnwfqqkpgkspktliyranrlvdgvps
rfsgggsgqdysltisslefedigiyyclqydefpptfgggtrleik

SCOPe Domain Coordinates for d2ypvl1:

Click to download the PDB-style file with coordinates for d2ypvl1.
(The format of our PDB-style files is described here.)

Timeline for d2ypvl1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2ypvl2