Lineage for d2yp7a1 (2yp7 A:8-327)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2775473Fold b.19: Viral protein domain [49817] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll; form trimers
  4. 2775474Superfamily b.19.1: Viral protein domain [49818] (4 families) (S)
    forms homotrimers
  5. 2775521Family b.19.1.2: Influenza hemagglutinin headpiece [49823] (2 proteins)
  6. 2776025Protein automated matches [190291] (19 species)
    not a true protein
  7. 2776136Species Influenza A virus, different strains [TaxId:11320] [187142] (19 PDB entries)
  8. 2776140Domain d2yp7a1: 2yp7 A:8-327 [207705]
    automated match to d1ha0a1
    complexed with epe, nag, tam

Details for d2yp7a1

PDB Entry: 2yp7 (more details), 1.85 Å

PDB Description: haemagglutinin of 2005 human h3n2 virus
PDB Compounds: (A:) Hemagglutinin

SCOPe Domain Sequences for d2yp7a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2yp7a1 b.19.1.2 (A:8-327) automated matches {Influenza A virus, different strains [TaxId: 11320]}
nstatlclghhavpngtivktitndqievtnatelvqssstggicdsphqildgenctli
dallgdpqcdgfqnkkwdlfverskaysncypydvpdyaslrslvassgtlefnnesfnw
tgvtqngtssackrksnnsffsrlnwlthlkfkypalnvtmpnnekfdklyiwgvhhpgt
dndqiflyaqasgritvstkrsqqtvipnigsrprvrnipsrisiywtivkpgdillins
tgnliaprgyfkirsgkssimrsdapigkcnsecitpngsipndkpfqnvnritygacpr
yvkqntlklatgmrnvpekq

SCOPe Domain Coordinates for d2yp7a1:

Click to download the PDB-style file with coordinates for d2yp7a1.
(The format of our PDB-style files is described here.)

Timeline for d2yp7a1: