Class b: All beta proteins [48724] (178 folds) |
Fold b.19: Viral protein domain [49817] (1 superfamily) sandwich; 9 strands in 2 sheets; jelly-roll; form trimers |
Superfamily b.19.1: Viral protein domain [49818] (4 families) forms homotrimers |
Family b.19.1.2: Influenza hemagglutinin headpiece [49823] (2 proteins) |
Protein automated matches [190291] (21 species) not a true protein |
Species Influenza A virus, different strains [TaxId:11320] [187142] (20 PDB entries) |
Domain d2yp4a1: 2yp4 A:8-328 [207703] automated match to d1ha0a1 complexed with epe, nag, tam |
PDB Entry: 2yp4 (more details), 1.85 Å
SCOPe Domain Sequences for d2yp4a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2yp4a1 b.19.1.2 (A:8-328) automated matches {Influenza A virus, different strains [TaxId: 11320]} nstatlclghhavpngtivktitndqievtnatelvqssstggicdsphqildgenctli dallgdpqcdgfqnkkwdlfverskaysncypydvpdyaslrslvassgtlefnnesfnw tgvtqngtssackrrsnnsffsrlnwlthlkfkypalnvtmpnnekfdklyiwgvhhpgt dndqislyaqasgritvstkrsqqtvipnigsrprvrdipsrisiywtivkpgdillins tgnliaprgyfkirsgkssimrsdapigkcnsecitpngsipndkpfqnvnritygacpr yvkqntlklatgmrnvpekqt
Timeline for d2yp4a1: