SCOP 1.57: Domain d1qqdb1: 1qqd B:

Lineage for d1qqdb1 (1qqd B:)

1. Root: SCOP 1.57

2. Class b: All beta proteins [48724] (104 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)

6. Protein Class I MHC, beta2-microglobulin and alpha-3 domain [48945] (19 species)

7. Species Human (Homo sapiens), HLA-CW4 [TaxId:9606] [48956] (2 PDB entries)

8. Domain d1qqdb1: 1qqd B: [20770]
   Other proteins in same PDB: d1qqda2

Details for d1qqdb1

PDB Entry: 1qqd, 2.7 Å

PDB Description: crystal structure of hla-cw4, a ligand for the kir2d natural killer cell inhibitory receptor

SCOP Domain Sequences for d1qqdb1:

Sequence; same for both SEQRES and ATOM records:

>d1qqdb1 b.1.1.2 (B:) Class I MHC, beta2-microglobulin and alpha-3 domain {Human (Homo sapiens), HLA-CW4}
miqrtpkiqvysrhpaengksnflncyvsgfhpsdievdllkngeriekvehsdlsfsgd
wsfyllyyteftptekdeyacrvnhvtlsqpkivkwdrd

Timeline for d1qqdb1:

• d1qqdb1 first appeared (with stable ids) in SCOP 1.55
  
• d1qqdb1 appears in SCOP 1.59
  
• d1qqdb1 appears in the current release, SCOPe 2.08, called d1qqdb_