Class b: All beta proteins [48724] (177 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.18: E set domains [81296] (24 families) "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies |
Family b.1.18.0: automated matches [191341] (1 protein) not a true family |
Protein automated matches [190226] (55 species) not a true protein |
Species Bacillus amyloliquefaciens [TaxId:1390] [197052] (4 PDB entries) |
Domain d2yoxb_: 2yox B: [207698] automated match to d2yoya_ complexed with cu1 |
PDB Entry: 2yox (more details), 1.9 Å
SCOPe Domain Sequences for d2yoxb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2yoxb_ b.1.18.0 (B:) automated matches {Bacillus amyloliquefaciens [TaxId: 1390]} hgyikepvsraymgalekqtmgwtaaaqkygsvidnpqsvegpkgfpaagppdgriasan ggsgqidfgldkqtadhwvkqnirggfntftwhytaphatskwhyyitkknwnpnkplsr defeligtvnhdgskadtnlthkifvptdrsgyhiilgvwdvadtsnafynvidvnlt
Timeline for d2yoxb_: