SCOPe 2.06: Domain d2yoxb_: 2yox B:

Lineage for d2yoxb_ (2yox B:)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.18: E set domains [81296] (24 families)
   "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies

5. Family b.1.18.0: automated matches [191341] (1 protein)
   not a true family

6. Protein automated matches [190226] (55 species)
   not a true protein

7. Species Bacillus amyloliquefaciens [TaxId:1390] [197052] (4 PDB entries)

8. Domain d2yoxb_: 2yox B: [207698]
   automated match to d2yoya_
   complexed with cu1

Details for d2yoxb_

PDB Entry: 2yox, 1.9 Å

PDB Description: Bacillus amyloliquefaciens CBM33 in complex with Cu(I) after photoreduction

PDB Compounds: (B:) rbam17540

SCOPe Domain Sequences for d2yoxb_:

Sequence; same for both SEQRES and ATOM records:

>d2yoxb_ b.1.18.0 (B:) automated matches {Bacillus amyloliquefaciens [TaxId: 1390]}
hgyikepvsraymgalekqtmgwtaaaqkygsvidnpqsvegpkgfpaagppdgriasan
ggsgqidfgldkqtadhwvkqnirggfntftwhytaphatskwhyyitkknwnpnkplsr
defeligtvnhdgskadtnlthkifvptdrsgyhiilgvwdvadtsnafynvidvnlt

Timeline for d2yoxb_:

• d2yoxb_ first appeared in SCOPe 2.03
  
• d2yoxb_ appears in SCOPe 2.05
  
• d2yoxb_ appears in SCOPe 2.07
  
• d2yoxb_ appears in the current release, SCOPe 2.08