SCOPe 2.03: Domain d2yoha_: 2yoh A:

Lineage for d2yoha_ (2yoh A:)

1. Root: SCOPe 2.03

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.0: automated matches [191323] (1 protein)
   not a true family

6. Protein automated matches [190123] (58 species)
   not a true protein

7. Species Plasmodium falciparum [TaxId:36329] [193845] (8 PDB entries)

8. Domain d2yoha_: 2yoh A: [207695]
   automated match to d3tmke_
   complexed with wmj

Details for d2yoha_

PDB Entry: 2yoh, 1.6 Å

PDB Description: Plasmodium falciparum thymidylate kinase in complex with a urea-alpha- deoxythymidine inhibitor

PDB Compounds: (A:) thymidylate kinase

SCOPe Domain Sequences for d2yoha_:

Sequence, based on SEQRES records:

>d2yoha_ c.37.1.0 (A:) automated matches {Plasmodium falciparum [TaxId: 36329]}
dkkkgkfivfegldrsgkstqskllveylknnnvevkhlyfpnretgigqiiskylkmen
smsnetihllfsanrwehmneikslllkgiwvvcdryaysgvayssgalnlnktwcmnpd
qglikpdvvfylnvppnyaqnrsdygeeiyekvetqkkiyetykhfahedywinidatrk
iedihndivkevtkikvepeefnflws

Sequence, based on observed residues (ATOM records):

>d2yoha_ c.37.1.0 (A:) automated matches {Plasmodium falciparum [TaxId: 36329]}
dkkkgkfivfegldrsgkstqskllveylknnnvevkhlyfpnretgigqiiskylkmen
smsnetihllfsanrwehmneikslllkgiwvvcdryaysgvayssgalnlnktwcmnpd
qglikpdvvfylnvppnyeeiyekvetqkkiyetykhfahedywinidatrkiedihndi
vkevtkikvepeefnflws

Timeline for d2yoha_:

• d2yoha_ is new in SCOPe 2.03-stable
  
• d2yoha_ appears in SCOPe 2.04
  
• d2yoha_ appears in the current release, SCOPe 2.08