Lineage for d2yofc_ (2yof C:)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1362078Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 1362079Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families) (S)
    division into families based on beta-sheet topologies
  5. 1366119Family c.37.1.0: automated matches [191323] (1 protein)
    not a true family
  6. 1366120Protein automated matches [190123] (58 species)
    not a true protein
  7. 1366487Species Plasmodium falciparum [TaxId:36329] [193845] (8 PDB entries)
  8. 1366497Domain d2yofc_: 2yof C: [207692]
    automated match to d3tmke_
    complexed with 74w, act, tam

Details for d2yofc_

PDB Entry: 2yof (more details), 1.82 Å

PDB Description: Plasmodium falciparum thymidylate kinase in complex with a (thio)urea- beta-deoxythymidine inhibitor
PDB Compounds: (C:) thymidylate kinase

SCOPe Domain Sequences for d2yofc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2yofc_ c.37.1.0 (C:) automated matches {Plasmodium falciparum [TaxId: 36329]}
ddkkkgkfivfegldrsgkstqskllveylknnnvevkhlyfpnretgigqiiskylkme
nsmsnetihllfsanrwehmneikslllkgiwvvcdryaysgvayssgalnlnktwcmnp
dqglikpdvvfylnvppnyaqnrsdygeeiyekvetqkkiyetykhfahedywinidatr
kiedihndivkevtkikvepeefnflws

SCOPe Domain Coordinates for d2yofc_:

Click to download the PDB-style file with coordinates for d2yofc_.
(The format of our PDB-style files is described here.)

Timeline for d2yofc_: