Lineage for d1qqda1 (1qqd A:182-274)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 6993Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)
  4. 6994Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 8163Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)
  6. 8170Protein Class I MHC, beta2-microglobulin and alpha-3 domain [48945] (19 species)
  7. 8294Species Human (Homo sapiens), HLA-CW4 [TaxId:9606] [48956] (1 PDB entry)
  8. 8295Domain d1qqda1: 1qqd A:182-274 [20769]
    Other proteins in same PDB: d1qqda2

Details for d1qqda1

PDB Entry: 1qqd (more details), 2.7 Å

PDB Description: crystal structure of hla-cw4, a ligand for the kir2d natural killer cell inhibitory receptor

SCOP Domain Sequences for d1qqda1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qqda1 b.1.1.2 (A:182-274) Class I MHC, beta2-microglobulin and alpha-3 domain {Human (Homo sapiens), HLA-CW4}
aehpkthvthhpvsdheatlrcwalgfypaeitltwqwdgedqtqdtelvetrpagdgtf
qkwaavvvpsgeeqrytchvqheglpepltlrw

SCOP Domain Coordinates for d1qqda1:

Click to download the PDB-style file with coordinates for d1qqda1.
(The format of our PDB-style files is described here.)

Timeline for d1qqda1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1qqda2
View in 3D
Domains from other chains:
(mouse over for more information)
d1qqdb1