Lineage for d2ynga2 (2yng A:430-558)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1857400Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 1859086Superfamily c.55.3: Ribonuclease H-like [53098] (15 families) (S)
    consists of one domain of this fold
  5. 1860195Family c.55.3.0: automated matches [191357] (1 protein)
    not a true family
  6. 1860196Protein automated matches [190396] (30 species)
    not a true protein
  7. 1860258Species Hiv-1 m:b_hxb2r [TaxId:11706] [225268] (21 PDB entries)
  8. 1860260Domain d2ynga2: 2yng A:430-558 [207673]
    Other proteins in same PDB: d2ynga1, d2yngb_
    automated match to d1bqna1
    complexed with mg, srt, whu

Details for d2ynga2

PDB Entry: 2yng (more details), 2.12 Å

PDB Description: HIV-1 Reverse Transcriptase in complex with inhibitor GSK560
PDB Compounds: (A:) Reverse transcriptase/ribonuclease H

SCOPe Domain Sequences for d2ynga2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ynga2 c.55.3.0 (A:430-558) automated matches {Hiv-1 m:b_hxb2r [TaxId: 11706]}
ekepivgaetfyvdgaanretklgkagyvtnrgrqkvvtltdttnqktelqaiylalqds
glevnivtdsqyalgiiqaqpdqseselvnqiieqlikkekvylawvpahkgiggneqvd
klvsagirk

SCOPe Domain Coordinates for d2ynga2:

Click to download the PDB-style file with coordinates for d2ynga2.
(The format of our PDB-style files is described here.)

Timeline for d2ynga2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2ynga1
View in 3D
Domains from other chains:
(mouse over for more information)
d2yngb_