SCOPe 2.04: Domain d2ykma1: 2ykm A:1-429

Lineage for d2ykma1 (2ykm A:1-429)

1. Root: SCOPe 2.04

2. Class e: Multi-domain proteins (alpha and beta) [56572] (68 folds)

3. Fold e.8: DNA/RNA polymerases [56671] (1 superfamily)
   divided into morphological domains including "palm", "thumb" and "fingers"; the catalytic "palm" domain is conserved to all members

4. Superfamily e.8.1: DNA/RNA polymerases [56672] (7 families)
   "palm" domain has a ferredoxin-like fold, related to that of an adenylyl cyclase domain

5. Family e.8.1.2: Reverse transcriptase [56686] (3 proteins)

6. Protein automated matches [190211] (5 species)
   not a true protein

7. Species Human immunodeficiency virus type 1 bh10 [TaxId:11678] [225820] (9 PDB entries)

8. Domain d2ykma1: 2ykm A:1-429 [207657]
   Other proteins in same PDB: d2ykma2
   automated match to d1bqna2
   complexed with ca, ykn

Details for d2ykma1

PDB Entry: 2ykm, 2.9 Å

PDB Description: crystal structure of hiv-1 reverse transcriptase (rt) in complex with a difluoromethylbenzoxazole (dfmb) pyrimidine thioether derivative, a non-nucleoside rt inhibitor (nnrti)

PDB Compounds: (A:) Reverse transcriptase/ribonuclease H

SCOPe Domain Sequences for d2ykma1:

Sequence; same for both SEQRES and ATOM records:

>d2ykma1 e.8.1.2 (A:1-429) automated matches {Human immunodeficiency virus type 1 bh10 [TaxId: 11678]}
pispietvpvklkpgmdgpkvkqwplteekikalveictemekegkiskigpenpystpv
faikkkdstkwrklvdfrelnkrtqdfwevqlgiphpaglkkkksvtvldvgdayfsvpl
dedfrkytaftipsinnetpgiryqynvlpqgwkgspaifqssmtkilepfkkqnpdivi
yqymddlyvgsdleigqhrtkieelrqhllrwglttpdkkhqkeppclwmgyelhpdkwt
vqpivlpekdswtvndiqklvgklnwasqiypgikvrqlckllrgtkalteviplteeae
lelaenreilkepvhgvyydpskdliaeiqkqgqgqwtyqiyqepfknlktgkyarmrga
htndvkqlteavqkittesiviwgktpkfklpiqketwetwwteywqatwipewefvntp
plvklwyql

Timeline for d2ykma1:

• d2ykma1 first appeared in SCOPe 2.03
  
• d2ykma1 appears in SCOPe 2.05
  
• d2ykma1 appears in the current release, SCOPe 2.08