Class b: All beta proteins [48724] (177 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
Protein automated matches [190374] (16 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [187221] (698 PDB entries) |
Domain d2yk1l2: 2yk1 L:108-205 [207654] Other proteins in same PDB: d2yk1l1 automated match to d1aqkl2 complexed with nct |
PDB Entry: 2yk1 (more details), 1.85 Å
SCOPe Domain Sequences for d2yk1l2:
Sequence, based on SEQRES records: (download)
>d2yk1l2 b.1.1.2 (L:108-205) automated matches {Human (Homo sapiens) [TaxId: 9606]} qpkaapsvtlfppsseelqapkatlvclisdfypgavtvawkadsspvkagvetttpskq snnkyaassylsltpeqwkshrsyscqvthegstvekt
>d2yk1l2 b.1.1.2 (L:108-205) automated matches {Human (Homo sapiens) [TaxId: 9606]} qpkaapsvtlfppspkatlvclisdfypgavtvaagvetttpskqsnnkyaassylsltp eqwsyscqvthegstvekt
Timeline for d2yk1l2: