Lineage for d2yk1l2 (2yk1 L:108-205)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2021374Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2021375Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2025133Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2029182Protein automated matches [190374] (16 species)
    not a true protein
  7. 2029210Species Human (Homo sapiens) [TaxId:9606] [187221] (698 PDB entries)
  8. 2029304Domain d2yk1l2: 2yk1 L:108-205 [207654]
    Other proteins in same PDB: d2yk1l1
    automated match to d1aqkl2
    complexed with nct

Details for d2yk1l2

PDB Entry: 2yk1 (more details), 1.85 Å

PDB Description: structure of human anti-nicotine fab fragment in complex with nicotine
PDB Compounds: (L:) Fab fragment, light chain

SCOPe Domain Sequences for d2yk1l2:

Sequence, based on SEQRES records: (download)

>d2yk1l2 b.1.1.2 (L:108-205) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qpkaapsvtlfppsseelqapkatlvclisdfypgavtvawkadsspvkagvetttpskq
snnkyaassylsltpeqwkshrsyscqvthegstvekt

Sequence, based on observed residues (ATOM records): (download)

>d2yk1l2 b.1.1.2 (L:108-205) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qpkaapsvtlfppspkatlvclisdfypgavtvaagvetttpskqsnnkyaassylsltp
eqwsyscqvthegstvekt

SCOPe Domain Coordinates for d2yk1l2:

Click to download the PDB-style file with coordinates for d2yk1l2.
(The format of our PDB-style files is described here.)

Timeline for d2yk1l2: