Lineage for d2yjjh_ (2yjj H:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1989402Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 1989403Superfamily a.25.1: Ferritin-like [47240] (10 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 1991631Family a.25.1.0: automated matches [191307] (1 protein)
    not a true family
  6. 1991632Protein automated matches [190036] (39 species)
    not a true protein
  7. 1991807Species Microbacterium arborescens [TaxId:33883] [226147] (2 PDB entries)
  8. 1991827Domain d2yjjh_: 2yjj H: [207636]
    automated match to d1vele_
    complexed with fe, ofe

Details for d2yjjh_

PDB Entry: 2yjj (more details), 2.05 Å

PDB Description: structure of dps from microbacterium arborescens in the low iron form
PDB Compounds: (H:) afp

SCOPe Domain Sequences for d2yjjh_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2yjjh_ a.25.1.0 (H:) automated matches {Microbacterium arborescens [TaxId: 33883]}
pevaaaaaqfltpvvhkmqalvvngkqahwnvrgsnfiaihelldsvvahaqdyadtaae
rivalglpidsrvstmaektstavpagfaqwqdeikaivsdidaalvdlqaaidgldevd
ltsqdvaieikrgvdkdrwfllahlae

SCOPe Domain Coordinates for d2yjjh_:

Click to download the PDB-style file with coordinates for d2yjjh_.
(The format of our PDB-style files is described here.)

Timeline for d2yjjh_: