Lineage for d2yjje_ (2yjj E:)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1727563Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 1727564Superfamily a.25.1: Ferritin-like [47240] (10 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 1729675Family a.25.1.0: automated matches [191307] (1 protein)
    not a true family
  6. 1729676Protein automated matches [190036] (33 species)
    not a true protein
  7. 1729769Species Microbacterium arborescens [TaxId:33883] [226147] (2 PDB entries)
  8. 1729786Domain d2yjje_: 2yjj E: [207633]
    automated match to d1vele_
    complexed with fe, ofe

Details for d2yjje_

PDB Entry: 2yjj (more details), 2.05 Å

PDB Description: structure of dps from microbacterium arborescens in the low iron form
PDB Compounds: (E:) afp

SCOPe Domain Sequences for d2yjje_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2yjje_ a.25.1.0 (E:) automated matches {Microbacterium arborescens [TaxId: 33883]}
tadpevaaaaaqfltpvvhkmqalvvngkqahwnvrgsnfiaihelldsvvahaqdyadt
aaerivalglpidsrvstmaektstavpagfaqwqdeikaivsdidaalvdlqaaidgld
evdltsqdvaieikrgvdkdrwfllahlae

SCOPe Domain Coordinates for d2yjje_:

Click to download the PDB-style file with coordinates for d2yjje_.
(The format of our PDB-style files is described here.)

Timeline for d2yjje_: