Lineage for d2yjca_ (2yjc A:)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1398964Fold d.3: Cysteine proteinases [54000] (1 superfamily)
    consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn
  4. 1398965Superfamily d.3.1: Cysteine proteinases [54001] (23 families) (S)
    the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet
  5. 1399697Family d.3.1.0: automated matches [191342] (1 protein)
    not a true family
  6. 1399698Protein automated matches [190230] (14 species)
    not a true protein
  7. 1399710Species Human (Homo sapiens) [TaxId:9606] [187072] (29 PDB entries)
  8. 1399713Domain d2yjca_: 2yjc A: [207628]
    automated match to d3hd3b_
    complexed with 424

Details for d2yjca_

PDB Entry: 2yjc (more details), 1.14 Å

PDB Description: cathepsin l with a nitrile inhibitor
PDB Compounds: (A:) Cathepsin L1

SCOPe Domain Sequences for d2yjca_:

Sequence, based on SEQRES records: (download)

>d2yjca_ d.3.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
aprsvdwrekgyvtpvknqgqcgscwafsatgalegqmfrktgrlislseqnlvdcsgpq
gnegcngglmdyafqyvqdnggldseesypyeateesckynpkysvandtgfvdipkqek
almkavatvgpisvaidaghesflfykegiyfepdcssedmdhgvlvvgygfestesdnn
kywlvknswgeewgmggyvkmakdrrnhcgiasaasyptv

Sequence, based on observed residues (ATOM records): (download)

>d2yjca_ d.3.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
aprsvdwrekgyvtpvknqgqcgscwafsatgalegqmfrktgrlislseqnlvdcsgpq
gnegcngglmdyafqyvqdnggldseesypyeateesckynpkysvandtgfvdipkqek
almkavatvgpisvaidaghesflfykegiyfepdcssedmdhgvlvvgygfestsdnnk
ywlvknswgeewgmggyvkmakdrrnhcgiasaasyptv

SCOPe Domain Coordinates for d2yjca_:

Click to download the PDB-style file with coordinates for d2yjca_.
(The format of our PDB-style files is described here.)

Timeline for d2yjca_: