![]() | Class b: All beta proteins [48724] (141 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (22 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (4 families) ![]() |
![]() | Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (22 proteins) |
![]() | Protein Class I MHC, alpha-3 domain [88604] (3 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [88605] (65 PDB entries) |
![]() | Domain d1a9ba1: 1a9b A:182-277 [20759] Other proteins in same PDB: d1a9ba2, d1a9bb_, d1a9bd2, d1a9be_ |
PDB Entry: 1a9b (more details), 3.2 Å
SCOP Domain Sequences for d1a9ba1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1a9ba1 b.1.1.2 (A:182-277) Class I MHC, alpha-3 domain {Human (Homo sapiens)} adppkthvthhpvsdheatlrcwalgfypaeitltwqrdgedqtqdtelvetrpagdrtf qkwaavvvpsgeeqrytchvqheglpkpltlrweps
Timeline for d1a9ba1:
![]() Domains from other chains: (mouse over for more information) d1a9bb_, d1a9bd1, d1a9bd2, d1a9be_ |