Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.58: Aminoacid dehydrogenase-like, N-terminal domain [53222] (1 superfamily) core: 3 layers: a/b/a; parallel beta-sheet of 4 strands; 2134 |
Superfamily c.58.1: Aminoacid dehydrogenase-like, N-terminal domain [53223] (6 families) |
Family c.58.1.0: automated matches [227157] (1 protein) not a true family |
Protein automated matches [226864] (21 species) not a true protein |
Species Peptoniphilus asaccharolyticus [TaxId:1258] [226258] (1 PDB entry) |
Domain d2yfqa1: 2yfq A:6-180 [207570] Other proteins in same PDB: d2yfqa2, d2yfqb2 automated match to d1euza2 complexed with so4 |
PDB Entry: 2yfq (more details), 2.94 Å
SCOPe Domain Sequences for d2yfqa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2yfqa1 c.58.1.0 (A:6-180) automated matches {Peptoniphilus asaccharolyticus [TaxId: 1258]} nplvaaqekvriaceklgcdpavyellkepqrvieisipvkmddgtvkvfkgwrsahssa vgpskggvrfhpnvnmdevkalslwmtfkggalglpygggkggicvdpaelsereleqls rgwvrglykylgdridipapdvntngqimswfvdeyvklngermdigtftgkpva
Timeline for d2yfqa1: