Lineage for d2yfqa1 (2yfq A:6-180)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1610013Fold c.58: Aminoacid dehydrogenase-like, N-terminal domain [53222] (1 superfamily)
    core: 3 layers: a/b/a; parallel beta-sheet of 4 strands; 2134
  4. 1610014Superfamily c.58.1: Aminoacid dehydrogenase-like, N-terminal domain [53223] (6 families) (S)
  5. 1610318Family c.58.1.0: automated matches [227157] (1 protein)
    not a true family
  6. 1610319Protein automated matches [226864] (21 species)
    not a true protein
  7. 1610410Species Peptoniphilus asaccharolyticus [TaxId:1258] [226258] (1 PDB entry)
  8. 1610411Domain d2yfqa1: 2yfq A:6-180 [207570]
    Other proteins in same PDB: d2yfqa2, d2yfqb2
    automated match to d1euza2
    complexed with so4

Details for d2yfqa1

PDB Entry: 2yfq (more details), 2.94 Å

PDB Description: Crystal structure of Glutamate dehydrogenase from Peptoniphilus asaccharolyticus
PDB Compounds: (A:) nad-specific glutamate dehydrogenase

SCOPe Domain Sequences for d2yfqa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2yfqa1 c.58.1.0 (A:6-180) automated matches {Peptoniphilus asaccharolyticus [TaxId: 1258]}
nplvaaqekvriaceklgcdpavyellkepqrvieisipvkmddgtvkvfkgwrsahssa
vgpskggvrfhpnvnmdevkalslwmtfkggalglpygggkggicvdpaelsereleqls
rgwvrglykylgdridipapdvntngqimswfvdeyvklngermdigtftgkpva

SCOPe Domain Coordinates for d2yfqa1:

Click to download the PDB-style file with coordinates for d2yfqa1.
(The format of our PDB-style files is described here.)

Timeline for d2yfqa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2yfqa2