SCOP 1.55: Domain d1a9ea1: 1a9e A:182-277

Lineage for d1a9ea1 (1a9e A:182-277)

1. Root: SCOP 1.55

2. Class b: All beta proteins [48724] (93 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)

6. Protein Class I MHC, beta2-microglobulin and alpha-3 domain [48945] (19 species)

7. Species Human (Homo sapiens), HLA-B*3501 [TaxId:9606] [48953] (3 PDB entries)

8. Domain d1a9ea1: 1a9e A:182-277 [20757]
   Other proteins in same PDB: d1a9ea2

Details for d1a9ea1

PDB Entry: 1a9e, 2.5 Å

PDB Description: decamer-like conformation of a nano-peptide bound to hla-b3501 due to nonstandard positioning of the c-terminus

SCOP Domain Sequences for d1a9ea1:

Sequence; same for both SEQRES and ATOM records:

>d1a9ea1 b.1.1.2 (A:182-277) Class I MHC, beta2-microglobulin and alpha-3 domain {Human (Homo sapiens), HLA-B*3501}
adppkthvthhpvsdheatlrcwalgfypaeitltwqrdgedqtqdtelvetrpagdrtf
qkwaavvvpsgeeqrytchvqheglpkpltlrweps

Timeline for d1a9ea1:

• d1a9ea1 appears in SCOP 1.57
  
• d1a9ea1 appears in the current release, SCOPe 2.08