SCOPe 2.04: Domain d2yf1a2: 2yf1 A:178-270

Lineage for d2yf1a2 (2yf1 A:178-270)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (19 species)
   not a true protein

7. Species Chicken (Gallus gallus) [TaxId:9031] [188287] (16 PDB entries)

8. Domain d2yf1a2: 2yf1 A:178-270 [207568]
   Other proteins in same PDB: d2yf1a1
   automated match to d1de4a1
   complexed with ca, edo

Details for d2yf1a2

PDB Entry: 2yf1, 2.75 Å

PDB Description: complex of a b21 chicken mhc class i molecule and a 11mer chicken peptide

PDB Compounds: (A:) Major histocompatibility complex class I glycoprotein haplotype B21

SCOPe Domain Sequences for d2yf1a2:

Sequence; same for both SEQRES and ATOM records:

>d2yf1a2 b.1.1.0 (A:178-270) automated matches {Chicken (Gallus gallus) [TaxId: 9031]}
rrerpevrvwgkeadgiltlscrahgfyprpivvswlkdgavrgqdaqsggivpngdgty
htwvtidaqpgdgdkyqcrvehaslpqpglysw

Timeline for d2yf1a2:

• d2yf1a2 first appeared in SCOPe 2.03
  
• d2yf1a2 appears in SCOPe 2.05
  
• d2yf1a2 appears in the current release, SCOPe 2.08