Lineage for d2ybvi1 (2ybv I:23-150)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2192663Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2195894Superfamily d.58.9: RuBisCO, large subunit, small (N-terminal) domain [54966] (2 families) (S)
    C-terminal domain is beta/alpha barrel
  5. 2196090Family d.58.9.0: automated matches [227234] (1 protein)
    not a true family
  6. 2196091Protein automated matches [226983] (18 species)
    not a true protein
  7. 2196341Species Thermosynechococcus elongatus [TaxId:197221] [226343] (2 PDB entries)
  8. 2196350Domain d2ybvi1: 2ybv I:23-150 [207533]
    Other proteins in same PDB: d2ybva2, d2ybvb_, d2ybvc2, d2ybvd_, d2ybve2, d2ybvf_, d2ybvg2, d2ybvh_, d2ybvi2, d2ybvj_, d2ybvk2, d2ybvl_, d2ybvm2, d2ybvn_, d2ybvo2, d2ybvp_
    automated match to d1wdda2
    complexed with cl

Details for d2ybvi1

PDB Entry: 2ybv (more details), 2.3 Å

PDB Description: structure of rubisco from thermosynechococcus elongatus
PDB Compounds: (I:) ribulose bisphosphate carboxylase large chain

SCOPe Domain Sequences for d2ybvi1:

Sequence, based on SEQRES records: (download)

>d2ybvi1 d.58.9.0 (I:23-150) automated matches {Thermosynechococcus elongatus [TaxId: 197221]}
tyytpdytpkdtdilaafrvtpqpgvpfeeaaaavaaesstgtwttvwtdlltdldrykg
ccydieplpgednqfiayiaypldlfeegsvtnmltsivgnvfgfkalkalrledlripv
aylktfqg

Sequence, based on observed residues (ATOM records): (download)

>d2ybvi1 d.58.9.0 (I:23-150) automated matches {Thermosynechococcus elongatus [TaxId: 197221]}
tyytpdytpkdtdilaafrvtpqpgvpfeeaaaavaaesstgwtdlltdldrykgccydi
eplpgednqfiayiaypldlfeegsvtnmltsivgnvfgfkalkalrledlripvaylkt
fqg

SCOPe Domain Coordinates for d2ybvi1:

Click to download the PDB-style file with coordinates for d2ybvi1.
(The format of our PDB-style files is described here.)

Timeline for d2ybvi1: