Lineage for d1agea1 (1age A:182-276)

  1. Root: SCOP 1.69
  2. 450777Class b: All beta proteins [48724] (144 folds)
  3. 450778Fold b.1: Immunoglobulin-like beta-sandwich [48725] (23 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 450779Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 452577Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)
  6. 452843Protein Class I MHC, alpha-3 domain [88604] (3 species)
  7. 452844Species Human (Homo sapiens) [TaxId:9606] [88605] (70 PDB entries)
  8. 452880Domain d1agea1: 1age A:182-276 [20749]
    Other proteins in same PDB: d1agea2, d1ageb_

Details for d1agea1

PDB Entry: 1age (more details), 2.3 Å

PDB Description: antagonist hiv-1 gag peptides induce structural changes in hla b8-hiv-1 gag peptide (ggkkkyrl-7r mutation)

SCOP Domain Sequences for d1agea1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1agea1 b.1.1.2 (A:182-276) Class I MHC, alpha-3 domain {Human (Homo sapiens)}
adppkthvthhpisdheatlrcwalgfypaeitltwqrdgedqtqdtelvetrpagdrtf
qkwaavvvpsgeeqrytchvqheglpkpltlrwep

SCOP Domain Coordinates for d1agea1:

Click to download the PDB-style file with coordinates for d1agea1.
(The format of our PDB-style files is described here.)

Timeline for d1agea1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1agea2
View in 3D
Domains from other chains:
(mouse over for more information)
d1ageb_