SCOPe 2.05: Domain d2y24a1: 2y24 A:31-43,A:321-413

Lineage for d2y24a1 (2y24 A:31-43,A:321-413)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily)
   folded sheet; greek-key

4. Superfamily b.71.1: Glycosyl hydrolase domain [51011] (6 families)
   this domain is C-terminal to the catalytic beta/alpha barrel domain

5. Family b.71.1.2: Composite domain of glycosyl hydrolase families 5, 30, 39 and 51 [89388] (4 proteins)
   interrupted by the catalytic domain; the C-terminal core is similar to the alpha-amylase domain

6. Protein Glycosyl hydrolase family 5 xylanase [101922] (1 species)

7. Species Erwinia chrysanthemi [TaxId:556] [101923] (2 PDB entries)

8. Domain d2y24a1: 2y24 A:31-43,A:321-413 [207457]
   Other proteins in same PDB: d2y24a2
   automated match to d1nofa1
   complexed with imd, pg4, pge

Details for d2y24a1

PDB Entry: 2y24, 1.39 Å

PDB Description: structural basis for substrate recognition by erwinia chrysanthemi gh5 glucuronoxylanase

PDB Compounds: (A:) xylanase

SCOPe Domain Sequences for d2y24a1:

Sequence; same for both SEQRES and ATOM records:

>d2y24a1 b.71.1.2 (A:31-43,A:321-413) Glycosyl hydrolase family 5 xylanase {Erwinia chrysanthemi [TaxId: 556]}
dtvkidanvnyqiXgalriqatenpqsnvhltaykntdgkmvivavntndsdqmlslnis
nanvtkfekystsaslnveyggssqvdssgkatvwlnplsvttfvsk

Timeline for d2y24a1:

• d2y24a1 first appeared in SCOPe 2.03
  
• d2y24a1 appears in SCOPe 2.04
  
• d2y24a1 appears in SCOPe 2.06
  
• d2y24a1 appears in the current release, SCOPe 2.08