Class b: All beta proteins [48724] (177 folds) |
Fold b.6: Cupredoxin-like [49502] (2 superfamilies) sandwich; 7 strands in 2 sheets, greek-key variations: some members have additional 1-2 strands |
Superfamily b.6.1: Cupredoxins [49503] (8 families) contains copper-binding site |
Family b.6.1.3: Multidomain cupredoxins [49550] (8 proteins) |
Protein Nitrite reductase, NIR [49551] (5 species) consists of two domains of this fold |
Species Achromobacter cycloclastes [TaxId:223] [49552] (25 PDB entries) |
Domain d2y1aa1: 2y1a A:8-166 [207448] automated match to d1nifa1 complexed with act, cu, no, so4 |
PDB Entry: 2y1a (more details), 1.95 Å
SCOPe Domain Sequences for d2y1aa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2y1aa1 b.6.1.3 (A:8-166) Nitrite reductase, NIR {Achromobacter cycloclastes [TaxId: 223]} distlprvkvdlvkppfvhahdqvaktgprvveftmtieekklvidregteihamtfngs vpgplmvvhendyvelrlinpdtntllhnidfhaatgalgggaltqvnpgeettlrfkat kpgvfvyhcapegmvpwhvtsgmngaimvlprdglkdek
Timeline for d2y1aa1: