Class b: All beta proteins [48724] (177 folds) |
Fold b.69: 7-bladed beta-propeller [50964] (15 superfamilies) consists of seven 4-stranded beta-sheet motifs; meander |
Superfamily b.69.6: Clathrin heavy-chain terminal domain [50989] (1 family) |
Family b.69.6.1: Clathrin heavy-chain terminal domain [50990] (2 proteins) |
Protein automated matches [227067] (1 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [226191] (3 PDB entries) |
Domain d2xzga1: 2xzg A:1-330 [207445] Other proteins in same PDB: d2xzga2, d2xzga3 automated match to d1utca2 complexed with act, gol, peg, vh1 |
PDB Entry: 2xzg (more details), 1.7 Å
SCOPe Domain Sequences for d2xzga1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2xzga1 b.69.6.1 (A:1-330) automated matches {Human (Homo sapiens) [TaxId: 9606]} maqilpirfqehlqlqnlginpanigfstltmesdkficirekvgeqaqvviidmndpsn pirrpisadsaimnpaskvialkagktlqifniemkskmkahtmtddvtfwkwislntva lvtdnavyhwsmegesqpvkmfdrhsslagcqiinyrtdakqkwllltgisaqqnrvvga mqlysvdrkvsqpieghaasfaqfkmegnaeestlfcfavrgqaggklhiievgtpptgn qpfpkkavdvffppeaqndfpvamqisekhdvvflitkygyihlydletgtciymnrisg etifvtapheatagiigvnrkgqvlsvcve
Timeline for d2xzga1: