Lineage for d2xzga1 (2xzg A:1-330)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2075644Fold b.69: 7-bladed beta-propeller [50964] (15 superfamilies)
    consists of seven 4-stranded beta-sheet motifs; meander
  4. 2076101Superfamily b.69.6: Clathrin heavy-chain terminal domain [50989] (1 family) (S)
  5. 2076102Family b.69.6.1: Clathrin heavy-chain terminal domain [50990] (2 proteins)
  6. 2076115Protein automated matches [227067] (1 species)
    not a true protein
  7. 2076116Species Human (Homo sapiens) [TaxId:9606] [226191] (3 PDB entries)
  8. 2076117Domain d2xzga1: 2xzg A:1-330 [207445]
    Other proteins in same PDB: d2xzga2, d2xzga3
    automated match to d1utca2
    complexed with act, gol, peg, vh1

Details for d2xzga1

PDB Entry: 2xzg (more details), 1.7 Å

PDB Description: clathrin terminal domain complexed with pitstop 1
PDB Compounds: (A:) Clathrin heavy chain 1

SCOPe Domain Sequences for d2xzga1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2xzga1 b.69.6.1 (A:1-330) automated matches {Human (Homo sapiens) [TaxId: 9606]}
maqilpirfqehlqlqnlginpanigfstltmesdkficirekvgeqaqvviidmndpsn
pirrpisadsaimnpaskvialkagktlqifniemkskmkahtmtddvtfwkwislntva
lvtdnavyhwsmegesqpvkmfdrhsslagcqiinyrtdakqkwllltgisaqqnrvvga
mqlysvdrkvsqpieghaasfaqfkmegnaeestlfcfavrgqaggklhiievgtpptgn
qpfpkkavdvffppeaqndfpvamqisekhdvvflitkygyihlydletgtciymnrisg
etifvtapheatagiigvnrkgqvlsvcve

SCOPe Domain Coordinates for d2xzga1:

Click to download the PDB-style file with coordinates for d2xzga1.
(The format of our PDB-style files is described here.)

Timeline for d2xzga1: