Lineage for d2xzcl1 (2xzc L:1-109)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2754035Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2754036Protein automated matches [190740] (31 species)
    not a true protein
  7. 2754280Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries)
  8. 2754371Domain d2xzcl1: 2xzc L:1-109 [207443]
    Other proteins in same PDB: d2xzcl2
    automated match to d1rhha1
    complexed with cl, xop

Details for d2xzcl1

PDB Entry: 2xzc (more details), 1.36 Å

PDB Description: crystal structure of phosphonate-modified recombinant a.17 antibody fab fragment
PDB Compounds: (L:) fab a.17 light chain

SCOPe Domain Sequences for d2xzcl1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2xzcl1 b.1.1.0 (L:1-109) automated matches {Human (Homo sapiens) [TaxId: 9606]}
esvltqppsvsaapgqkvtiscsgsssnignnyvswyqqlpgtapklliydnnkrpsgip
drfsgsksgtsatlgitglqtgdeadyycgtwdsslnpvfgggtkleik

SCOPe Domain Coordinates for d2xzcl1:

Click to download the PDB-style file with coordinates for d2xzcl1.
(The format of our PDB-style files is described here.)

Timeline for d2xzcl1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2xzcl2
View in 3D
Domains from other chains:
(mouse over for more information)
d2xzch_