SCOPe 2.05: Domain d2xy2a1: 2xy2 A:19-113

Lineage for d2xy2a1 (2xy2 A:19-113)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (26 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (558 PDB entries)

8. Domain d2xy2a1: 2xy2 A:19-113 [207430]
   automated match to d1epfa1
   complexed with gol, nag

Details for d2xy2a1

PDB Entry: 2xy2, 1.82 Å

PDB Description: crystal structure of ncam2 ig1-2

PDB Compounds: (A:) Neural cell adhesion molecule 2

SCOPe Domain Sequences for d2xy2a1:

Sequence; same for both SEQRES and ATOM records:

>d2xy2a1 b.1.1.0 (A:19-113) automated matches {Human (Homo sapiens) [TaxId: 9606]}
allqvtislskvelsvgeskfftctaigepesidwynpqgekiistqrvvvqkegvrsrl
tiynaniedagiyrcqatdakgqtqeatvvleiyq

Timeline for d2xy2a1:

• d2xy2a1 first appeared in SCOPe 2.03
  
• d2xy2a1 appears in SCOPe 2.04
  
• d2xy2a1 appears in SCOPe 2.06
  
• d2xy2a1 appears in the current release, SCOPe 2.08