Class d: Alpha and beta proteins (a+b) [53931] (380 folds) |
Fold d.162: LDH C-terminal domain-like [56326] (1 superfamily) unusual fold, defines family |
Superfamily d.162.1: LDH C-terminal domain-like [56327] (3 families) |
Family d.162.1.0: automated matches [227146] (1 protein) not a true family |
Protein automated matches [226850] (24 species) not a true protein |
Species Thermus thermophilus HB8 [TaxId:300852] [225328] (7 PDB entries) |
Domain d2xxjb2: 2xxj B:142-309 [207411] Other proteins in same PDB: d2xxja1, d2xxjb1, d2xxjc1, d2xxjd1 automated match to d1llda2 complexed with nad, oxm, so4; mutant |
PDB Entry: 2xxj (more details), 1.96 Å
SCOPe Domain Sequences for d2xxjb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2xxjb2 d.162.1.0 (B:142-309) automated matches {Thermus thermophilus HB8 [TaxId: 300852]} tildtarfrallaeylrvapqsvhayvlgehgdsevlvwssaqvggvpllefaeargral spedraridegvrraayriiegkgatyygigaglarlvrailtdekgvytvsaftpevag vlevslslprilgaggvagtvypslspeeraalrrsaeilkeaafalg
Timeline for d2xxjb2: