Lineage for d1agda1 (1agd A:182-276)

  1. Root: SCOP 1.61
  2. 157351Class b: All beta proteins [48724] (111 folds)
  3. 157352Fold b.1: Immunoglobulin-like beta-sandwich [48725] (17 superfamilies)
  4. 157353Superfamily b.1.1: Immunoglobulin [48726] (6 families) (S)
  5. 158799Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)
  6. 158811Protein Class I MHC, beta2-microglobulin and alpha-3 domain [48945] (20 species)
  7. 158939Species Human (Homo sapiens), HLA-B0801 [TaxId:9606] [48951] (5 PDB entries)
  8. 158940Domain d1agda1: 1agd A:182-276 [20741]
    Other proteins in same PDB: d1agda2

Details for d1agda1

PDB Entry: 1agd (more details), 2.05 Å

PDB Description: antagonist hiv-1 gag peptides induce structural changes in hla b8-hiv-1 gag peptide (ggkkkykl-index peptide)

SCOP Domain Sequences for d1agda1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1agda1 b.1.1.2 (A:182-276) Class I MHC, beta2-microglobulin and alpha-3 domain {Human (Homo sapiens), HLA-B0801}
adppkthvthhpisdheatlrcwalgfypaeitltwqrdgedqtqdtelvetrpagdrtf
qkwaavvvpsgeeqrytchvqheglpkpltlrwep

SCOP Domain Coordinates for d1agda1:

Click to download the PDB-style file with coordinates for d1agda1.
(The format of our PDB-style files is described here.)

Timeline for d1agda1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1agda2
View in 3D
Domains from other chains:
(mouse over for more information)
d1agdb1