SCOP 1.57: Domain d2hlaa1: 2hla A:182-270

Lineage for d2hlaa1 (2hla A:182-270)

1. Root: SCOP 1.57

2. Class b: All beta proteins [48724] (104 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)

6. Protein Class I MHC, beta2-microglobulin and alpha-3 domain [48945] (19 species)

7. Species Human (Homo sapiens), HLA-AW68 [TaxId:9606] [48950] (3 PDB entries)

8. Domain d2hlaa1: 2hla A:182-270 [20739]
   Other proteins in same PDB: d2hlaa2

Details for d2hlaa1

PDB Entry: 2hla, 2.6 Å

PDB Description: specificity pockets for the side chains of peptide antigens in hla- aw68

SCOP Domain Sequences for d2hlaa1:

Sequence; same for both SEQRES and ATOM records:

>d2hlaa1 b.1.1.2 (A:182-270) Class I MHC, beta2-microglobulin and alpha-3 domain {Human (Homo sapiens), HLA-AW68}
tdapkthmthhavsdheatlrcwalsfypaeitltwqrdgedqtqdtelvetrpagdgtf
qkwvavvvpsgqeqrytchvqheglpkpl

Timeline for d2hlaa1:

• d2hlaa1 first appeared (with stable ids) in SCOP 1.55
  
• d2hlaa1 appears in SCOP 1.59
  
• d2hlaa1 appears in the current release, SCOPe 2.08