Lineage for d2xx0a2 (2xx0 A:160-336)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2770398Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands
  4. 2770399Superfamily b.6.1: Cupredoxins [49503] (8 families) (S)
    contains copper-binding site
  5. 2771244Family b.6.1.3: Multidomain cupredoxins [49550] (15 proteins)
  6. 2772015Protein automated matches [226877] (4 species)
    not a true protein
  7. 2772030Species Achromobacter xylosoxidans [TaxId:85698] [225099] (11 PDB entries)
  8. 2772032Domain d2xx0a2: 2xx0 A:160-336 [207385]
    Other proteins in same PDB: d2xx0b3
    automated match to d1oe1a2
    complexed with cu, mes, pg4, zn; mutant

Details for d2xx0a2

PDB Entry: 2xx0 (more details), 1.46 Å

PDB Description: structure of the n90s-h254f mutant of nitrite reductase from alcaligenes xylosoxidans
PDB Compounds: (A:) dissimilatory copper-containing nitrite reductase

SCOPe Domain Sequences for d2xx0a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2xx0a2 b.6.1.3 (A:160-336) automated matches {Achromobacter xylosoxidans [TaxId: 85698]}
qgkplhydraytigefdlyipkgpdgkykdyatlaesygdtvqvmrtltpshivfngkvg
altganaltakvgetvllihsqanrdtrphliggfgdwvwetgkfanppqrdletwfirg
gsagaalytfkqpgvyaylnhnlieafelgaaghikvegkwnddlmkqikapapipr

SCOPe Domain Coordinates for d2xx0a2:

Click to download the PDB-style file with coordinates for d2xx0a2.
(The format of our PDB-style files is described here.)

Timeline for d2xx0a2: