Class b: All beta proteins [48724] (93 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies) |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins) |
Protein Class I MHC, beta2-microglobulin and alpha-3 domain [48945] (19 species) |
Species Human (Homo sapiens), HLA-AW68 [TaxId:9606] [48950] (3 PDB entries) |
Domain d1hsbb1: 1hsb B: [20737] Other proteins in same PDB: d1hsba2 |
PDB Entry: 1hsb (more details), 1.9 Å
SCOP Domain Sequences for d1hsbb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1hsbb1 b.1.1.2 (B:) Class I MHC, beta2-microglobulin and alpha-3 domain {Human (Homo sapiens), HLA-AW68} iqrtpkiqvysrhpaengksnflncyvsgfhpsdievdllkngeriekvehsdlsfskdw sfyllyyteftptekdeyacrvnhvtlsqpkivkwdrdm
Timeline for d1hsbb1: