SCOP 1.61: Domain d1hsba1: 1hsb A:182-270

Lineage for d1hsba1 (1hsb A:182-270)

1. Root: SCOP 1.61

2. Class b: All beta proteins [48724] (111 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (17 superfamilies)

4. Superfamily b.1.1: Immunoglobulin [48726] (6 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)

6. Protein Class I MHC, beta2-microglobulin and alpha-3 domain [48945] (20 species)

7. Species Human (Homo sapiens), HLA-AW68 [TaxId:9606] [48950] (3 PDB entries)

8. Domain d1hsba1: 1hsb A:182-270 [20736]
   Other proteins in same PDB: d1hsba2

Details for d1hsba1

PDB Entry: 1hsb, 1.9 Å

PDB Description: different length peptides bind to hla-aw68 similarly at their ends but bulge out in the middle

SCOP Domain Sequences for d1hsba1:

Sequence; same for both SEQRES and ATOM records:

>d1hsba1 b.1.1.2 (A:182-270) Class I MHC, beta2-microglobulin and alpha-3 domain {Human (Homo sapiens), HLA-AW68}
tdapkthmthhavsdheatlrcwalsfypaeitltwqrdgedqtqdtelvetrpagdgtf
qkwvavvvpsgqeqrytchvqheglpkpl

Timeline for d1hsba1:

• d1hsba1 first appeared (with stable ids) in SCOP 1.55
  
• d1hsba1 appears in SCOP 1.59
  
• d1hsba1 appears in SCOP 1.63
  
• d1hsba1 appears in the current release, SCOPe 2.08