SCOP 1.63: Domain d1hsad1: 1hsa D:182-276

Lineage for d1hsad1 (1hsa D:182-276)

1. Root: SCOP 1.63

2. Class b: All beta proteins [48724] (119 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)

6. Protein Class I MHC, beta2-microglobulin and alpha-3 domain [48945] (20 species)

7. Species Human (Homo sapiens), HLA-B2705 [TaxId:9606] [48949] (3 PDB entries)

8. Domain d1hsad1: 1hsa D:182-276 [20734]
   Other proteins in same PDB: d1hsaa2, d1hsad2

Details for d1hsad1

PDB Entry: 1hsa, 2.1 Å

PDB Description: the three-dimensional structure of hla-b27 at 2.1 angstroms resolution suggests a general mechanism for tight peptide binding to mhc

SCOP Domain Sequences for d1hsad1:

Sequence; same for both SEQRES and ATOM records:

>d1hsad1 b.1.1.2 (D:182-276) Class I MHC, beta2-microglobulin and alpha-3 domain {Human (Homo sapiens), HLA-B2705}
adppkthvthhpisdheatlrcwalgfypaeitltwqrdgedqtqdtelvetrpagdrtf
qkwaavvvpsgeeqrytchvqheglpkpltlrwep

Timeline for d1hsad1:

• d1hsad1 first appeared (with stable ids) in SCOP 1.55
  
• d1hsad1 appears in SCOP 1.61
  
• d1hsad1 appears in SCOP 1.65
  
• d1hsad1 appears in the current release, SCOPe 2.08