SCOPe 2.03: Domain d2xtjd_: 2xtj D:

Lineage for d2xtjd_ (2xtj D:)

1. Root: SCOPe 2.03

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (23 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (336 PDB entries)

8. Domain d2xtjd_: 2xtj D: [207337]
   Other proteins in same PDB: d2xtjb_
   automated match to d3k80a_
   complexed with ca

Details for d2xtjd_

PDB Entry: 2xtj, 2.7 Å

PDB Description: the crystal structure of pcsk9 in complex with 1d05 fab

PDB Compounds: (D:) fab from a human monoclonal antibody, 1d05

SCOPe Domain Sequences for d2xtjd_:

Sequence; same for both SEQRES and ATOM records:

>d2xtjd_ b.1.1.0 (D:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qvqlvqsgaevkkpgssvkvsckasggtfnshaiswvrqapgqglewmgginpilgiany
aqkfqgrvtitadeststaymelsslrsedtavyycarhyeiqigrygmnvyylmyrfas
wgqgtlvtvss

Timeline for d2xtjd_:

• d2xtjd_ is new in SCOPe 2.03-stable
  
• d2xtjd_ appears in SCOPe 2.04
  
• d2xtjd_ appears in the current release, SCOPe 2.08