Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily) beta(3)-alpha(3); meander and up-and-down bundle |
Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families) |
Family d.54.1.0: automated matches [227195] (1 protein) not a true family |
Protein automated matches [226922] (88 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [225519] (3 PDB entries) |
Domain d2xsxa1: 2xsx A:1-140 [207330] Other proteins in same PDB: d2xsxa2, d2xsxb2, d2xsxb3 automated match to d1pdza2 complexed with edo, mg, po4 |
PDB Entry: 2xsx (more details), 1.7 Å
SCOPe Domain Sequences for d2xsxa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2xsxa1 d.54.1.0 (A:1-140) automated matches {Human (Homo sapiens) [TaxId: 9606]} mamqkifareildsrgnptvevdlhtakgrfraavpsgastgiyealelrdgdkgrylgk gvlkaveninstlgpallqkklsvadqekvdkfmieldgtenkskfganailgvslavck agaaekgvplyrhiadlagn
Timeline for d2xsxa1: