Lineage for d2xsxa1 (2xsx A:1-140)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2191243Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily)
    beta(3)-alpha(3); meander and up-and-down bundle
  4. 2191244Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families) (S)
  5. 2191540Family d.54.1.0: automated matches [227195] (1 protein)
    not a true family
  6. 2191541Protein automated matches [226922] (88 species)
    not a true protein
  7. 2191899Species Human (Homo sapiens) [TaxId:9606] [225519] (3 PDB entries)
  8. 2191900Domain d2xsxa1: 2xsx A:1-140 [207330]
    Other proteins in same PDB: d2xsxa2, d2xsxb2, d2xsxb3
    automated match to d1pdza2
    complexed with edo, mg, po4

Details for d2xsxa1

PDB Entry: 2xsx (more details), 1.7 Å

PDB Description: crystal structure of human beta enolase enob
PDB Compounds: (A:) beta-enolase

SCOPe Domain Sequences for d2xsxa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2xsxa1 d.54.1.0 (A:1-140) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mamqkifareildsrgnptvevdlhtakgrfraavpsgastgiyealelrdgdkgrylgk
gvlkaveninstlgpallqkklsvadqekvdkfmieldgtenkskfganailgvslavck
agaaekgvplyrhiadlagn

SCOPe Domain Coordinates for d2xsxa1:

Click to download the PDB-style file with coordinates for d2xsxa1.
(The format of our PDB-style files is described here.)

Timeline for d2xsxa1: