SCOPe 2.08: Domain d2xsxa1: 2xsx A:1-140

Lineage for d2xsxa1 (2xsx A:1-140)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily)
   beta(3)-alpha(3); meander and up-and-down bundle

4. Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families)

5. Family d.54.1.0: automated matches [227195] (1 protein)
   not a true family

6. Protein automated matches [226922] (95 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [225519] (3 PDB entries)

8. Domain d2xsxa1: 2xsx A:1-140 [207330]
   Other proteins in same PDB: d2xsxa2, d2xsxb2, d2xsxb3
   automated match to d1pdza2
   complexed with edo, mg, po4

Details for d2xsxa1

PDB Entry: 2xsx, 1.7 Å

PDB Description: crystal structure of human beta enolase enob

PDB Compounds: (A:) beta-enolase

SCOPe Domain Sequences for d2xsxa1:

Sequence; same for both SEQRES and ATOM records:

>d2xsxa1 d.54.1.0 (A:1-140) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mamqkifareildsrgnptvevdlhtakgrfraavpsgastgiyealelrdgdkgrylgk
gvlkaveninstlgpallqkklsvadqekvdkfmieldgtenkskfganailgvslavck
agaaekgvplyrhiadlagn

Timeline for d2xsxa1:

• d2xsxa1 first appeared in SCOPe 2.03
  
• d2xsxa1 appears in SCOPe 2.07