Lineage for d2xsfa_ (2xsf A:)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1413688Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 1415602Superfamily d.58.7: RNA-binding domain, RBD [54928] (6 families) (S)
  5. 1416109Family d.58.7.0: automated matches [191529] (1 protein)
    not a true family
  6. 1416110Protein automated matches [190896] (3 species)
    not a true protein
  7. 1416164Species Mouse (Mus musculus) [TaxId:10090] [226227] (1 PDB entry)
  8. 1416165Domain d2xsfa_: 2xsf A: [207329]
    automated match to d3md1b_
    complexed with gol, so4

Details for d2xsfa_

PDB Entry: 2xsf (more details), 1.7 Å

PDB Description: crystal structure of the rrm domain of mouse deleted in azoospermia-like
PDB Compounds: (A:) deleted in azoospermia-like

SCOPe Domain Sequences for d2xsfa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2xsfa_ d.58.7.0 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
gkimpntvfvggidvrmdeteirsffarygsvkevkiitdrtgvskgygfvsfyndvdvq
kivesqinfhgkklklgpair

SCOPe Domain Coordinates for d2xsfa_:

Click to download the PDB-style file with coordinates for d2xsfa_.
(The format of our PDB-style files is described here.)

Timeline for d2xsfa_: