Lineage for d2xsdc1 (2xsd C:247-319)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1732724Fold a.35: lambda repressor-like DNA-binding domains [47412] (1 superfamily)
    core: 4 helices; folded leaf, closed
  4. 1732725Superfamily a.35.1: lambda repressor-like DNA-binding domains [47413] (14 families) (S)
  5. 1733172Family a.35.1.0: automated matches [191534] (1 protein)
    not a true family
  6. 1733173Protein automated matches [190907] (8 species)
    not a true protein
  7. 1733247Species Mouse (Mus musculus) [TaxId:10090] [226005] (1 PDB entry)
  8. 1733248Domain d2xsdc1: 2xsd C:247-319 [207327]
    Other proteins in same PDB: d2xsdc2
    automated match to d1cqta2
    protein/DNA complex; complexed with edo

Details for d2xsdc1

PDB Entry: 2xsd (more details), 2.05 Å

PDB Description: crystal structure of the dimeric oct-6 (pou3f1) pou domain bound to palindromic more dna
PDB Compounds: (C:) pou domain, class 3, transcription factor 1

SCOPe Domain Sequences for d2xsdc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2xsdc1 a.35.1.0 (C:247-319) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
apssddleqfakqfkqrriklgftqadvglalgtlygnvfsqtticrfealqlsfknmck
lkpllnkwleetd

SCOPe Domain Coordinates for d2xsdc1:

Click to download the PDB-style file with coordinates for d2xsdc1.
(The format of our PDB-style files is described here.)

Timeline for d2xsdc1: