![]() | Class b: All beta proteins [48724] (176 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
![]() | Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
![]() | Protein Class I MHC, alpha-3 domain [88604] (4 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [88605] (189 PDB entries) Uniprot P30685 25-300 ! Uniprot P30443 25-298 # 1A01_HUMAN HLA class I histocompatibility antigen, A-1 alpha chain precursor ! Uniprot P30481 25-300 ! Uniprot P01892 25-298 ! Uniprot P13746 25-299 # 1A11_HUMAN HLA class I histocompatibility antigen, A-11 alpha chain precursor |
![]() | Domain d1hsaa1: 1hsa A:182-276 [20732] Other proteins in same PDB: d1hsaa2, d1hsab_, d1hsad2, d1hsae_ |
PDB Entry: 1hsa (more details), 2.1 Å
SCOPe Domain Sequences for d1hsaa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1hsaa1 b.1.1.2 (A:182-276) Class I MHC, alpha-3 domain {Human (Homo sapiens) [TaxId: 9606]} adppkthvthhpisdheatlrcwalgfypaeitltwqrdgedqtqdtelvetrpagdrtf qkwaavvvpsgeeqrytchvqheglpkpltlrwep
Timeline for d1hsaa1:
![]() Domains from other chains: (mouse over for more information) d1hsab_, d1hsad1, d1hsad2, d1hsae_ |