Lineage for d1hsaa1 (1hsa A:182-276)

  1. Root: SCOP 1.61
  2. 157351Class b: All beta proteins [48724] (111 folds)
  3. 157352Fold b.1: Immunoglobulin-like beta-sandwich [48725] (17 superfamilies)
  4. 157353Superfamily b.1.1: Immunoglobulin [48726] (6 families) (S)
  5. 158799Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)
  6. 158811Protein Class I MHC, beta2-microglobulin and alpha-3 domain [48945] (20 species)
  7. 158950Species Human (Homo sapiens), HLA-B2705 [TaxId:9606] [48949] (1 PDB entry)
  8. 158951Domain d1hsaa1: 1hsa A:182-276 [20732]
    Other proteins in same PDB: d1hsaa2, d1hsad2

Details for d1hsaa1

PDB Entry: 1hsa (more details), 2.1 Å

PDB Description: the three-dimensional structure of hla-b27 at 2.1 angstroms resolution suggests a general mechanism for tight peptide binding to mhc

SCOP Domain Sequences for d1hsaa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hsaa1 b.1.1.2 (A:182-276) Class I MHC, beta2-microglobulin and alpha-3 domain {Human (Homo sapiens), HLA-B2705}
adppkthvthhpisdheatlrcwalgfypaeitltwqrdgedqtqdtelvetrpagdrtf
qkwaavvvpsgeeqrytchvqheglpkpltlrwep

SCOP Domain Coordinates for d1hsaa1:

Click to download the PDB-style file with coordinates for d1hsaa1.
(The format of our PDB-style files is described here.)

Timeline for d1hsaa1: