Lineage for d2xqyk1 (2xqy K:1-107)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2754035Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2754036Protein automated matches [190740] (31 species)
    not a true protein
  7. 2759478Species Mouse (Mus musculus) [TaxId:10090] [188198] (836 PDB entries)
  8. 2759854Domain d2xqyk1: 2xqy K:1-107 [207319]
    Other proteins in same PDB: d2xqyk2, d2xqyl2
    automated match to d1dqdl1
    complexed with nag

Details for d2xqyk1

PDB Entry: 2xqy (more details), 2.05 Å

PDB Description: crystal structure of pseudorabies core fragment of glycoprotein h in complex with fab d6.3
PDB Compounds: (K:) a13-d6.3 monoclonal antibody

SCOPe Domain Sequences for d2xqyk1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2xqyk1 b.1.1.0 (K:1-107) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
divltqspaslalslgqratiscrasksvstsgysymywyqqkpgqppklliylasnles
gvparfsgsgsgtdftlnihpveeedaatyycqhsrelpwtfgggtklein

SCOPe Domain Coordinates for d2xqyk1:

Click to download the PDB-style file with coordinates for d2xqyk1.
(The format of our PDB-style files is described here.)

Timeline for d2xqyk1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2xqyk2