Lineage for d2xpwa1 (2xpw A:3-67)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2305222Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 2305223Superfamily a.4.1: Homeodomain-like [46689] (20 families) (S)
    consists only of helices
  5. 2305653Family a.4.1.9: Tetracyclin repressor-like, N-terminal domain [46764] (35 proteins)
  6. 2305891Protein Tetracyclin repressor (Tet-repressor, TetR) [46765] (1 species)
  7. 2305892Species Escherichia coli [TaxId:562] [46766] (36 PDB entries)
  8. 2305893Domain d2xpwa1: 2xpw A:3-67 [207317]
    Other proteins in same PDB: d2xpwa2, d2xpwa3
    automated match to d1bjza1
    complexed with cl, mes, mg, otc

Details for d2xpwa1

PDB Entry: 2xpw (more details), 1.44 Å

PDB Description: tetr(d) in complex with oxytetracycline and magnesium.
PDB Compounds: (A:) tetracycline repressor protein class d

SCOPe Domain Sequences for d2xpwa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2xpwa1 a.4.1.9 (A:3-67) Tetracyclin repressor (Tet-repressor, TetR) {Escherichia coli [TaxId: 562]}
rlnresvidaalellnetgidglttrklaqklgieqptlywhvknkralldalaveilar
hhdys

SCOPe Domain Coordinates for d2xpwa1:

Click to download the PDB-style file with coordinates for d2xpwa1.
(The format of our PDB-style files is described here.)

Timeline for d2xpwa1: