| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
Superfamily a.4.1: Homeodomain-like [46689] (21 families) ![]() consists only of helices |
| Family a.4.1.9: Tetracyclin repressor-like, N-terminal domain [46764] (35 proteins) |
| Protein Tetracyclin repressor (Tet-repressor, TetR) [46765] (1 species) |
| Species Escherichia coli [TaxId:562] [46766] (36 PDB entries) |
| Domain d2xpwa1: 2xpw A:3-67 [207317] Other proteins in same PDB: d2xpwa2, d2xpwa3 automated match to d1bjza1 complexed with cl, mes, mg, otc |
PDB Entry: 2xpw (more details), 1.44 Å
SCOPe Domain Sequences for d2xpwa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2xpwa1 a.4.1.9 (A:3-67) Tetracyclin repressor (Tet-repressor, TetR) {Escherichia coli [TaxId: 562]}
rlnresvidaalellnetgidglttrklaqklgieqptlywhvknkralldalaveilar
hhdys
Timeline for d2xpwa1: