SCOPe 2.03: Domain d2xpua1: 2xpu A:2-67

Lineage for d2xpua1 (2xpu A:2-67)

1. Root: SCOPe 2.03

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.1: Homeodomain-like [46689] (20 families)
   consists only of helices

5. Family a.4.1.9: Tetracyclin repressor-like, N-terminal domain [46764] (35 proteins)

6. Protein Tetracyclin repressor (Tet-repressor, TetR) [46765] (1 species)

7. Species Escherichia coli [TaxId:562] [46766] (25 PDB entries)

8. Domain d2xpua1: 2xpu A:2-67 [207313]
   Other proteins in same PDB: d2xpua2
   automated match to d1bjza1
   complexed with cl, so4, tdc

Details for d2xpua1

PDB Entry: 2xpu, 1.55 Å

PDB Description: tetr(d) in complex with anhydrotetracycline.

PDB Compounds: (A:) tetracycline repressor protein class d

SCOPe Domain Sequences for d2xpua1:

Sequence; same for both SEQRES and ATOM records:

>d2xpua1 a.4.1.9 (A:2-67) Tetracyclin repressor (Tet-repressor, TetR) {Escherichia coli [TaxId: 562]}
srlnresvidaalellnetgidglttrklaqklgieqptlywhvknkralldalaveila
rhhdys

Timeline for d2xpua1:

• d2xpua1 is new in SCOPe 2.03-stable
  
• d2xpua1 appears in SCOPe 2.04
  
• d2xpua1 appears in the current release, SCOPe 2.08