SCOP 1.69: Domain d1i1fd1: 1i1f D:182-275

Lineage for d1i1fd1 (1i1f D:182-275)

1. Root: SCOP 1.69

2. Class b: All beta proteins [48724] (144 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (23 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)

6. Protein Class I MHC, alpha-3 domain [88604] (3 species)

7. Species Human (Homo sapiens) [TaxId:9606] [88605] (70 PDB entries)

8. Domain d1i1fd1: 1i1f D:182-275 [20730]
   Other proteins in same PDB: d1i1fa2, d1i1fb_, d1i1fd2, d1i1fe_

Details for d1i1fd1

PDB Entry: 1i1f, 2.8 Å

PDB Description: crystal structure of human class i mhc (hla-a2.1) complexed with beta 2-microglobulin and hiv-rt variant peptide i1y

SCOP Domain Sequences for d1i1fd1:

Sequence; same for both SEQRES and ATOM records:

>d1i1fd1 b.1.1.2 (D:182-275) Class I MHC, alpha-3 domain {Human (Homo sapiens)}
tdapkthmthhavsdheatlrcwalsfypaeitltwqrdgedqtqdtelvetrpagdgtf
qkwaavvvpsgqeqrytchvqheglpkpltlrwe

Timeline for d1i1fd1:

• d1i1fd1 first appeared (with stable ids) in SCOP 1.55
  
• d1i1fd1 appears in SCOP 1.67
  
• d1i1fd1 appears in SCOP 1.71
  
• d1i1fd1 appears in the current release, SCOPe 2.08