Lineage for d2xofb_ (2xof B:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2700837Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 2700838Superfamily a.25.1: Ferritin-like [47240] (10 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 2703310Family a.25.1.2: Ribonucleotide reductase-like [47253] (9 proteins)
  6. 2703463Protein Ribonucleotide reductase R2 [47257] (10 species)
  7. 2703497Species Escherichia coli [TaxId:562] [47258] (24 PDB entries)
  8. 2703537Domain d2xofb_: 2xof B: [207289]
    automated match to d1jqcb_
    complexed with feo

Details for d2xofb_

PDB Entry: 2xof (more details), 2.2 Å

PDB Description: ribonucleotide reductase y122no2y modified r2 subunit of e. coli
PDB Compounds: (B:) ribonucleoside-diphosphate reductase 1 subunit beta

SCOPe Domain Sequences for d2xofb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2xofb_ a.25.1.2 (B:) Ribonucleotide reductase R2 {Escherichia coli [TaxId: 562]}
ayttfsqtkndqlkepmffgqpvnvarydqqkydifekliekqlsffwrpeevdvsrdri
dyqalpehekhifisnlkyqtlldsiqgrspnvallplisipeletwvetwafsetihsr
sythiirnivndpsvvfddivtneqiqkraegissyydeliemtsywhllgegthtvngk
tvtvslrelkkklylclmsvnaleairfyvsfacsfafaerelmegnakiirliardeal
hltgtqhmlnllrsgaddpemaeiaeeckqecydlfvqaaqqekdwadylfrdgsmigln
kdilcqyveyitnirmqavgldlpfqtrsnpipwintwlvs

SCOPe Domain Coordinates for d2xofb_:

Click to download the PDB-style file with coordinates for d2xofb_.
(The format of our PDB-style files is described here.)

Timeline for d2xofb_: