![]() | Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
![]() | Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
![]() | Superfamily d.15.6: Superantigen toxins, C-terminal domain [54334] (2 families) ![]() |
![]() | Family d.15.6.1: Superantigen toxins, C-terminal domain [54335] (16 proteins) |
![]() | Protein Staphylococcal enterotoxin H, SEH [54346] (1 species) |
![]() | Species Staphylococcus aureus [TaxId:1280] [54347] (5 PDB entries) |
![]() | Domain d2xnac2: 2xna C:102-215 [207278] Other proteins in same PDB: d2xnaa1, d2xnaa2, d2xnab1, d2xnab2, d2xnac1 automated match to d1f77a2 complexed with gol, na |
PDB Entry: 2xna (more details), 2.1 Å
SCOPe Domain Sequences for d2xnac2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2xnac2 d.15.6.1 (C:102-215) Staphylococcal enterotoxin H, SEH {Staphylococcus aureus [TaxId: 1280]} eklaqerviganvwvdgiqketelirtnkknvtlqeldikirkilsdkykiyykdseisk gliefdmktprdysfdiydlkgendyeidkiyednktlksddishidvnlytkk
Timeline for d2xnac2:
![]() Domains from other chains: (mouse over for more information) d2xnaa1, d2xnaa2, d2xnab1, d2xnab2 |