SCOPe 2.03: Domain d2xnac1: 2xna C:1-101

Lineage for d2xnac1 (2xna C:1-101)

1. Root: SCOPe 2.03

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.40: OB-fold [50198] (16 superfamilies)
   barrel, closed or partly opened n=5, S=10 or S=8; greek-key

4. Superfamily b.40.2: Bacterial enterotoxins [50203] (3 families)

5. Family b.40.2.2: Superantigen toxins, N-terminal domain [50219] (16 proteins)

6. Protein Staphylococcal enterotoxin H, SEH [50230] (1 species)

7. Species Staphylococcus aureus [TaxId:1280] [50231] (5 PDB entries)

8. Domain d2xnac1: 2xna C:1-101 [207277]
   Other proteins in same PDB: d2xnaa1, d2xnaa2, d2xnab1, d2xnab2, d2xnac2
   automated match to d1f77a1
   complexed with gol, na

Details for d2xnac1

PDB Entry: 2xna, 2.1 Å

PDB Description: crystal structure of the complex between human t cell receptor and staphylococcal enterotoxin

PDB Compounds: (C:) enterotoxin h

SCOPe Domain Sequences for d2xnac1:

Sequence; same for both SEQRES and ATOM records:

>d2xnac1 b.40.2.2 (C:1-101) Staphylococcal enterotoxin H, SEH {Staphylococcus aureus [TaxId: 1280]}
edlhdkseltdlalanaygqynhpfikeniksdeisgekdlifrnqgdsgndlrvkfata
dlaqkfknknvdiygasfyykcekiseniseclyggttlns

Timeline for d2xnac1:

• d2xnac1 is new in SCOPe 2.03-stable
  
• d2xnac1 appears in SCOPe 2.04
  
• d2xnac1 appears in the current release, SCOPe 2.08