SCOPe 2.07: Domain d2xknc1: 2xkn C:1-107

Lineage for d2xknc1 (2xkn C:1-107)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (29 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [188198] (822 PDB entries)

8. Domain d2xknc1: 2xkn C:1-107 [207265]
   Other proteins in same PDB: d2xkna2, d2xknc2
   automated match to d2fatl1
   complexed with pe4

Details for d2xknc1

PDB Entry: 2xkn, 1.4 Å

PDB Description: crystal structure of the fab fragment of the anti-egfr antibody 7a7

PDB Compounds: (C:) anti-egfr antibody 7a7

SCOPe Domain Sequences for d2xknc1:

Sequence; same for both SEQRES and ATOM records:

>d2xknc1 b.1.1.0 (C:1-107) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
diqmtqttsslsaslgdrvtiscrasqdisnylnwyqqkpdgtvklliyytsrlhsgvts
rfsgsgsgtdysltisnleqediatyfcqqgntlpwtfgggtkveik

Timeline for d2xknc1:

• d2xknc1 first appeared in SCOPe 2.03
  
• d2xknc1 appears in SCOPe 2.06
  
• d2xknc1 appears in the current release, SCOPe 2.08