Lineage for d2xhlb1 (2xhl B:461-549)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2528985Fold d.92: Zincin-like [55485] (2 superfamilies)
    contains mixed beta sheet with connection over free side of the sheet
  4. 2528986Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (18 families) (S)
  5. 2530179Family d.92.1.0: automated matches [191495] (1 protein)
    not a true family
  6. 2530180Protein automated matches [190805] (17 species)
    not a true protein
  7. 2530187Species Clostridium botulinum [TaxId:1491] [193827] (7 PDB entries)
  8. 2530193Domain d2xhlb1: 2xhl B:461-549 [207256]
    Other proteins in same PDB: d2xhlb2
    automated match to d1epwa3
    complexed with zn

Details for d2xhlb1

PDB Entry: 2xhl (more details), 2.8 Å

PDB Description: structure of a functional derivative of clostridium botulinum neurotoxin type b
PDB Compounds: (B:) botulinum neurotoxin b heavy chain

SCOPe Domain Sequences for d2xhlb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2xhlb1 d.92.1.0 (B:461-549) automated matches {Clostridium botulinum [TaxId: 1491]}
cidvdnedlffiadknsfsddlsknerieyntqsnyiendfpinelildtdliskielps
entesltdfnvdvpvyekqpaikkiftde

SCOPe Domain Coordinates for d2xhlb1:

Click to download the PDB-style file with coordinates for d2xhlb1.
(The format of our PDB-style files is described here.)

Timeline for d2xhlb1: