SCOPe 2.03: Domain d2xh4d2: 2xh4 D:141-438

Lineage for d2xh4d2 (2xh4 D:141-438)

1. Root: SCOPe 2.03

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.11: Enolase C-terminal domain-like [51604] (3 families)
   binds metal ion (magnesium or manganese) in conserved site inside barrel
   N-terminal alpha+beta domain is common to this superfamily

5. Family c.1.11.0: automated matches [227196] (1 protein)
   not a true family

6. Protein automated matches [226923] (45 species)
   not a true protein

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [226794] (5 PDB entries)

8. Domain d2xh4d2: 2xh4 D:141-438 [207246]
   Other proteins in same PDB: d2xh4a1, d2xh4b1, d2xh4c1, d2xh4d1
   automated match to d1pdza1
   complexed with 2pg, mg; mutant

Details for d2xh4d2

PDB Entry: 2xh4, 1.7 Å

PDB Description: engineering the enolase active site pocket: crystal structure of the s39a d321a mutant of yeast enolase 1

PDB Compounds: (D:) enolase 1

SCOPe Domain Sequences for d2xh4d2:

Sequence, based on SEQRES records:

>d2xh4d2 c.1.11.0 (D:141-438) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
tspyvlpvpflnvlnggshaggalalqefmiaptgaktfaealrigsevyhnlksltkkr
ygasagnvgdeggvapniqtaeealdlivdaikaaghdgkikigldcasseffkdgkydl
dfknpnsdkskwltgpqladlyhslmkrypivsiedpfaeddweawshffktagiqivad
altvtnpkriataiekkaadalllkvnqigtlsesikaaqdsfaagwgvmvshrsgeted
tfiadlvvglrtgqiktgaparserlaklnqllrieeelgdnavfagenfhhgdkllh

Sequence, based on observed residues (ATOM records):

>d2xh4d2 c.1.11.0 (D:141-438) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
tspyvlpvpflnvlnggshaggalalqefmiaptgaktfaealrigsevyhnlksltkkr
ygasagnvgdeggvapniqtaeealdlivdaikaaghdgkikigldcasseffkdgkydl
dfknnsdkskwltgpqladlyhslmkrypivsiedpfaeddweawshffktagiqivada
ltvtnpkriataiekkaadalllkvnqigtlsesikaaqdsfaagwgvmvshrsgetedt
fiadlvvglrtgqiktgaparserlaklnqllrieeelgdnavfagenfhhgdkllh

Timeline for d2xh4d2:

• d2xh4d2 is new in SCOPe 2.03-stable
  
• d2xh4d2 appears in SCOPe 2.04
  
• d2xh4d2 appears in the current release, SCOPe 2.08